Targeting DNA-binding Proteins DLPred : An Accurate Sequence-Based Predictor for Protein-protein Interaction Sites Predition
| Home | Download | Citation | Output example | Read me |
sequence fasta...
>1A9NA
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR
prediction sites...
NNNNNNNNNNNNIINNINNINNNNNNINNNNNNNNNNNNNNNNNNNNNNIIIININNNNNNNNNNNNNNINIIIINIINNNNNNNNNNNNNININIIIINIINNNNNNNNNNNNNNNNNNNININIIIINNNNNNNNNNNNNIIIIIIIIIIIIININNNINNNNNNNNNNNNNNN
 
Supported by Qiang Lab